PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KZV45078.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Gesneriaceae; Didymocarpoideae; Trichosporeae; Loxocarpinae; Dorcoceras
Family HD-ZIP
Protein Properties Length: 278aa    MW: 31030 Da    PI: 7.7065
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KZV45078.1genomeCNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.74.6e-19141195256
                 T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
    Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                 rk+ +++keq  +Lee F+++++++ +++  LAk+l+L  rqV vWFqNrRa+ k
  KZV45078.1 141 RKKLRLSKEQAAVLEETFKEHSTLNPKQKMGLAKQLNLRPRQVEVWFQNRRARTK 195
                 788899***********************************************98 PP

2HD-ZIP_I/II127.36.8e-41141230191
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                  +kk+rlskeq+++LEe+F+e+++L+p++K+ la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+L+r++++l+een+rL+kev++Lr +l
   KZV45078.1 141 RKKLRLSKEQAAVLEETFKEHSTLNPKQKMGLAKQLNLRPRQVEVWFQNRRARTKLKQTEVDCEYLRRCCENLTEENRRLQKEVNDLR-AL 230
                  69*************************************************************************************9.44 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046186.1E-221117IPR006712HD-ZIP protein, N-terminal
PROSITE profilePS5007117.281137197IPR001356Homeobox domain
SMARTSM003892.1E-14139201IPR001356Homeobox domain
SuperFamilySSF466891.37E-18140206IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.6E-18141195IPR009057Homeodomain-like
PfamPF000461.4E-16141195IPR001356Homeobox domain
CDDcd000863.06E-15141198No hitNo description
PROSITE patternPS000270172195IPR017970Homeobox, conserved site
PfamPF021831.0E-10197231IPR003106Leucine zipper, homeobox-associated
SMARTSM003403.0E-25197240IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 278 aa     Download sequence    Send to blast
MAGKDDCLGL SLSLRCPENL NPDPLPPPPP TRLAVSAPFP LNLLRSPSPF MQLQKISRTD  60
AFQTVAARQA EPRAFHVGID INRTTSVVGC DEEDEEGMVT SPNSTVSSIS GKRSEREEND  120
GERAASSSME IEEDGGDAAS RKKLRLSKEQ AAVLEETFKE HSTLNPKQKM GLAKQLNLRP  180
RQVEVWFQNR RARTKLKQTE VDCEYLRRCC ENLTEENRRL QKEVNDLRAL KLSPHFYSNM  240
TPPTTLTMCP RCEHVASAAA PSRQPPTWAA AESDRSKS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1139145SRKKLRL
2189197RRARTKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011089804.11e-128PREDICTED: homeobox-leucine zipper protein HAT4-like
SwissprotP466027e-90HAT3_ARATH; Homeobox-leucine zipper protein HAT3
TrEMBLA0A068UP951e-108A0A068UP95_COFCA; Uncharacterized protein
STRINGSolyc01g090460.2.19e-96(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11182485
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60390.13e-91homeobox-leucine zipper protein 3